PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023565m
Common NameCARUB_v10023565mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 342aa    MW: 38112 Da    PI: 6.841
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023565mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.7e-33182238258
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h
  Carubv10023565m 182 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 238
                      8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381309.9E-1131341IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.3E-34166240IPR003657WRKY domain
SuperFamilySSF1182901.7E-28173239IPR003657WRKY domain
PROSITE profilePS5081130.963176241IPR003657WRKY domain
SMARTSM007741.0E-38181240IPR003657WRKY domain
PfamPF031067.8E-26182238IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEFTDFSKTS FYYPSSQSVW DFGDLAAAER NSLGFMDLLG SQPQYHDFPT VSPHSLPQHQ  60
SQTQTQLSTK LSSPVSTILQ APPPSHNAST AEQLVASKVE SLCSDHFLTN PPATPNSSIS  120
SASSEALNDE KPKREDNDGE EEDEQDKSHT NKQLKPKKKN NQKREREARV AFMTKSEVDH  180
LEDGYRWRKY GQKAVKNSPF PRSYYRCTTA SCNVKKRVER SFRDPSTVVT TYEGQHTHIS  240
PLTSRPISTG GFYGSSGAAS NLGNGCFGFP VESSALISPQ FQQLVHYHQQ QELLSCFGGA  300
NEYLNSHANE YGDEDRVKKS RSLVKDYGLL QDVVPSHMLK E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27171241777Probable WRKY transcription factor 4
2lex_A1e-27171241777Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1179180.0AK117918.1 Arabidopsis thaliana At2g47260 mRNA for putative WRKY-type DNA binding protein, complete cds, clone: RAFL19-10-C13.
GenBankAY0526470.0AY052647.1 Arabidopsis thaliana WRKY transcription factor 23 (WRKY23) mRNA, complete cds.
GenBankBT0062380.0BT006238.1 Arabidopsis thaliana At2g47260 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293500.10.0hypothetical protein CARUB_v10023565mg
SwissprotO229001e-177WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLR0HQZ60.0R0HQZ6_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0004_34320.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-140WRKY DNA-binding protein 23